(data stored in ACNUC9543 zone)

EMBL: CP000308.PE539

CP000308.PE539       Location/Qualifiers
FT   CDS             complement(624854..625114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12508"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSG3"
FT                   /protein_id="ABG12508.1"
FT                   /translation="MSMSEEYQPINCDDYDNLELACQHHLILTLKLRGGEIVEGKASDL
FT                   LLRKKVEYLIVEQEGTMRELRLDHIASFSHPEIGTVVVSAS"
     MSMSEEYQPI NCDDYDNLEL ACQHHLILTL KLRGGEIVEG KASDLLLRKK VEYLIVEQEG        60
     TMRELRLDHI ASFSHPEIGT VVVSAS                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page