(data stored in ACNUC9543 zone)

EMBL: CP000308.PE54

CP000308.PE54        Location/Qualifiers
FT   CDS             70870..71163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12023"
FT                   /db_xref="GOA:A0A0E1NW44"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW44"
FT                   /protein_id="ABG12023.1"
FT                   /translation="MNLNNKQKQHLKSLAHPLKPVVMLGNNGLTEGVLAEIEQTLAHHE
FT                   LIKVKITAEERETKALIADAIVRETGAVNVQMIGNILVLYRPAKERKIILPR"
     MNLNNKQKQH LKSLAHPLKP VVMLGNNGLT EGVLAEIEQT LAHHELIKVK ITAEERETKA        60
     LIADAIVRET GAVNVQMIGN ILVLYRPAKE RKIILPR                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page