(data stored in ACNUC9543 zone)

EMBL: CP000308.PE541

CP000308.PE541       Location/Qualifiers
FT   CDS             625543..626091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12510"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQZ8"
FT                   /protein_id="ABG12510.1"
FT                   /translation="MALKATIHKAAINIADMDRNFFQDINLTIAQHPSETDQRMMLRLL
FT                   AWICHADERLLFTKGLSADDEPEVWRHNDHNGIELWIELGLPEEKRLRKACNQSKQVVL
FT                   YAYSERAAKVWWPQVQEKLAGHRNLRVRFLDDEQMAKLAALSNRNMSLQATLQEGTIWL
FT                   SDVQNNLEISFAEWQNYGQ"
     MALKATIHKA AINIADMDRN FFQDINLTIA QHPSETDQRM MLRLLAWICH ADERLLFTKG        60
     LSADDEPEVW RHNDHNGIEL WIELGLPEEK RLRKACNQSK QVVLYAYSER AAKVWWPQVQ       120
     EKLAGHRNLR VRFLDDEQMA KLAALSNRNM SLQATLQEGT IWLSDVQNNL EISFAEWQNY       180
     GQ                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page