(data stored in ACNUC9543 zone)

EMBL: CP000308.PE542

CP000308.PE542       Location/Qualifiers
FT   CDS             626070..626510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12511"
FT                   /db_xref="GOA:A0A0H2Y5K7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5K7"
FT                   /protein_id="ABG12511.1"
FT                   /translation="MAKLRAISVLIISNSVTLASGEIELTAIRAQGAGGQHVNKTSTAI
FT                   HLRFDIKASSLPEYYKERLLLLNSHLVTAEGVVIIKAQEYRSQDMNREAALARLVALIR
FT                   QAMVVEKARRATKPTKGSKIRRVEGKVRKGATKALRGKIHQE"
     MAKLRAISVL IISNSVTLAS GEIELTAIRA QGAGGQHVNK TSTAIHLRFD IKASSLPEYY        60
     KERLLLLNSH LVTAEGVVII KAQEYRSQDM NREAALARLV ALIRQAMVVE KARRATKPTK       120
     GSKIRRVEGK VRKGATKALR GKIHQE                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page