(data stored in ACNUC9543 zone)

EMBL: CP000308.PE553

CP000308.PE553       Location/Qualifiers
FT   CDS             640750..641214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y497"
FT                   /protein_id="ABG12522.1"
FT                   /translation="MRWFFILVHPDGAETGSVKSVRMDMELPPSMCAVIVGTNLMRAYQ
FT                   RVGEQRVDNSIVKKHGNEAMDLQLSGLRPDNGSQVESAGQGNCEASIGTERMDTLLPFN
FT                   RGGRGDWNSWIGGDKENCVACYGGSGKGRIYEQRCLLEEVFYRKGLIYQQ"
     MRWFFILVHP DGAETGSVKS VRMDMELPPS MCAVIVGTNL MRAYQRVGEQ RVDNSIVKKH        60
     GNEAMDLQLS GLRPDNGSQV ESAGQGNCEA SIGTERMDTL LPFNRGGRGD WNSWIGGDKE       120
     NCVACYGGSG KGRIYEQRCL LEEVFYRKGL IYQQ                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page