(data stored in ACNUC9543 zone)

EMBL: CP000308.PE554

CP000308.PE554       Location/Qualifiers
FT   CDS             641596..642357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12523"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMX6"
FT                   /protein_id="ABG12523.1"
FT                   /translation="MRYVAGQPVEQIFPGAAKQLDKGLPLGEPLPTAELLRVVVWNIFK
FT                   QQRAGWLPVLKELGRDTQLMLLQEAQTTPELVRFATASYQAADQVPAFSLPQHPSGVMT
FT                   LAAAHPVYCCPLREREPLLRLSKSALVTVYPIHDGRLLMVVNIHAVNFSLGVDVYSKQL
FT                   DPIGDQIASHRGPVILAGDFNAWSRQRINALQHFAQDAGLQEVEFRVDHRSRAFGRPLD
FT                   FIFYRGLTVIDASVLVTRASDHNPLIVEFQP"
     MRYVAGQPVE QIFPGAAKQL DKGLPLGEPL PTAELLRVVV WNIFKQQRAG WLPVLKELGR        60
     DTQLMLLQEA QTTPELVRFA TASYQAADQV PAFSLPQHPS GVMTLAAAHP VYCCPLRERE       120
     PLLRLSKSAL VTVYPIHDGR LLMVVNIHAV NFSLGVDVYS KQLDPIGDQI ASHRGPVILA       180
     GDFNAWSRQR INALQHFAQD AGLQEVEFRV DHRSRAFGRP LDFIFYRGLT VIDASVLVTR       240
     ASDHNPLIVE FQP                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page