(data stored in ACNUC9543 zone)

EMBL: CP000308.PE563

CP000308.PE563       Location/Qualifiers
FT   CDS             complement(649863..650885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0564"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12532"
FT                   /db_xref="GOA:Q1BZX7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX7"
FT                   /protein_id="ABG12532.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
     MVTFETVMEI KILHKQGMSS RAIARELGIS RNTVKRYLQA KSEPPKYTPR PAVASLLDEY        60
     RDYIRQRIAD AHPYKIPATV IAREIRDQGY RGGMTILRAF IRSLSVPQEQ EPAVRFETEP       120
     GRQMQVDWGT MRNGRSPLHV FVAVLGYSRM LYIEFTDNMR YDTLETCHRN AFRFFGGVPR       180
     EVLYDNMKTV VLQRDAYQTG QHRFHPSLWQ FGKEMGFSPR LCRPFRAQTK GKVERMVQYT       240
     RNSFYIPLMT RLRPMGITVD VETANRHGLR WLHDVANQRK HETIQARPCD RWLEEQQSML       300
     ALPPEKKEYD VHLDENLVNF DKHPLHHPLS IYDSFCRGVA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page