(data stored in ACNUC9543 zone)

EMBL: CP000308.PE564

CP000308.PE564       Location/Qualifiers
FT   CDS             complement(650899..651075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12533"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVE2"
FT                   /protein_id="ABG12533.1"
FT                   /translation="MARTTRPLTHTEVQKAKTTDKDLTLHDGDGLFLLVVTNGAIVIHT
FT                   QRLKSDPGGNLLS"
     MARTTRPLTH TEVQKAKTTD KDLTLHDGDG LFLLVVTNGA IVIHTQRLKS DPGGNLLS          58
//

If you have problems or comments...

PBIL Back to PBIL home page