(data stored in ACNUC9543 zone)

EMBL: CP000308.PE565

CP000308.PE565       Location/Qualifiers
FT   CDS             651490..651807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0566"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12534"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT35"
FT                   /protein_id="ABG12534.1"
FT                   /translation="MKTIKHYLTPEGRDLYMEYLKSLRDSIAKAKISSRVNRIASGNFG
FT                   DHKPCREGVWELRIDQGPGYRVYYSLVDGEVVLLLLGGDKRSQNADIDQAIVCLKDYLT
FT                   R"
     MKTIKHYLTP EGRDLYMEYL KSLRDSIAKA KISSRVNRIA SGNFGDHKPC REGVWELRID        60
     QGPGYRVYYS LVDGEVVLLL LGGDKRSQNA DIDQAIVCLK DYLTR                       105
//

If you have problems or comments...

PBIL Back to PBIL home page