(data stored in ACNUC9543 zone)

EMBL: CP000308.PE569

CP000308.PE569       Location/Qualifiers
FT   CDS             complement(654513..655055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0570"
FT                   /product="putative prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12538"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMK3"
FT                   /protein_id="ABG12538.1"
FT                   /translation="MIFYFFLAGALQYNPFAAAKSVAGISVPKIFLIPSLVIQTWSFIG
FT                   MACAHPSMVAQAGAPKGAPVSKKSGNANSVWATTQGISVSGGSHYNYFLEAAQWLLPFT
FT                   VCTRNTFVPIRGCAMHNSSPLTIEEIVDHCHALVLAMLEITDPTAKELLLFILAERLDL
FT                   LQLMLDEVPDAEEANHE"
     MIFYFFLAGA LQYNPFAAAK SVAGISVPKI FLIPSLVIQT WSFIGMACAH PSMVAQAGAP        60
     KGAPVSKKSG NANSVWATTQ GISVSGGSHY NYFLEAAQWL LPFTVCTRNT FVPIRGCAMH       120
     NSSPLTIEEI VDHCHALVLA MLEITDPTAK ELLLFILAER LDLLQLMLDE VPDAEEANHE       180
//

If you have problems or comments...

PBIL Back to PBIL home page