(data stored in ACNUC9543 zone)

EMBL: CP000308.PE575

CP000308.PE575       Location/Qualifiers
FT   CDS             complement(659053..660141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12544"
FT                   /db_xref="InterPro:IPR025382"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPS3"
FT                   /protein_id="ABG12544.1"
FT                   /translation="MDSEDTSDNPLSEPQRESAGAQSYDRFEYQYHWALCKAFSSYKES
FT                   NDFAIFMEYHEDVVYANSIDKNKVKFTFNQIKANAKKTYTAKVLTKRENGTKPSLLGKL
FT                   CSSVSDKKYFEKVEKLDFITTSGFNLTKNNKLNLASYKLSSLSSDEASEIIKCLSDELA
FT                   NFGKFPQEIIHFTTSDIPLESYYEHTISRITDSVEEVYPQHLLRTKDIYRILMDSLRIR
FT                   GKNVFDYENWNDALTKKALTYKDIHTVVTKIVSKGNSDLNFEAIKYILDDLNLKGTIKA
FT                   KIIQKINSYSLTLLSPTLAIIKAQKEIQELLKKNSKKIEIEMSYELLERLIIDLSKDTI
FT                   GLFEDNISISSAIIYEMVEATN"
     MDSEDTSDNP LSEPQRESAG AQSYDRFEYQ YHWALCKAFS SYKESNDFAI FMEYHEDVVY        60
     ANSIDKNKVK FTFNQIKANA KKTYTAKVLT KRENGTKPSL LGKLCSSVSD KKYFEKVEKL       120
     DFITTSGFNL TKNNKLNLAS YKLSSLSSDE ASEIIKCLSD ELANFGKFPQ EIIHFTTSDI       180
     PLESYYEHTI SRITDSVEEV YPQHLLRTKD IYRILMDSLR IRGKNVFDYE NWNDALTKKA       240
     LTYKDIHTVV TKIVSKGNSD LNFEAIKYIL DDLNLKGTIK AKIIQKINSY SLTLLSPTLA       300
     IIKAQKEIQE LLKKNSKKIE IEMSYELLER LIIDLSKDTI GLFEDNISIS SAIIYEMVEA       360
     TN                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page