(data stored in ACNUC9543 zone)

EMBL: CP000308.PE578

CP000308.PE578       Location/Qualifiers
FT   CDS             complement(662736..663230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0579"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12547"
FT                   /db_xref="GOA:Q1CAH5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAH5"
FT                   /protein_id="ABG12547.1"
FT                   /translation="MTDTMTKKKAYKPGSATIAQNKRARHEYFIEEEFEAGLALQGWEV
FT                   KSLRAGKANISDSYVMFKNGEAFLFGATITPLNVASTHVVCEPMRTRKLLLNKRELDSL
FT                   FGRVNREGYTVVALSMYWKNAWVKVKIGVAKGKKDNDKRDDIRDREWKLDKARIMKHAN
FT                   R"
     MTDTMTKKKA YKPGSATIAQ NKRARHEYFI EEEFEAGLAL QGWEVKSLRA GKANISDSYV        60
     MFKNGEAFLF GATITPLNVA STHVVCEPMR TRKLLLNKRE LDSLFGRVNR EGYTVVALSM       120
     YWKNAWVKVK IGVAKGKKDN DKRDDIRDRE WKLDKARIMK HANR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page