(data stored in ACNUC9543 zone)

EMBL: CP000308.PE581

CP000308.PE581       Location/Qualifiers
FT   CDS             complement(664240..664581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12550"
FT                   /db_xref="GOA:A0A0E1NXF8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXF8"
FT                   /protein_id="ABG12550.1"
FT                   /translation="MRCKMLTAAAVMLAMLTAGCSTLEKVVYRPDINQGNYLSPIDASK
FT                   IHKGMTQQQVAYTLGTPMLQDPFGTQTWFYVFRQQPGHEKITQQTLTLTFDSSGVLTDI
FT                   KNEPALTGS"
     MRCKMLTAAA VMLAMLTAGC STLEKVVYRP DINQGNYLSP IDASKIHKGM TQQQVAYTLG        60
     TPMLQDPFGT QTWFYVFRQQ PGHEKITQQT LTLTFDSSGV LTDIKNEPAL TGS              113
//

If you have problems or comments...

PBIL Back to PBIL home page