(data stored in ACNUC9543 zone)

EMBL: CP000308.PE582

CP000308.PE582       Location/Qualifiers
FT   CDS             complement(664695..666356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0583"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12551"
FT                   /db_xref="GOA:A0A0E1NS81"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS81"
FT                   /protein_id="ABG12551.1"
FT                   /translation="MLVQLTISNFAIVRELEIDFQPGMTAITGETGAGKSIAVDALGLC
FT                   LGNRSDGSMVRLGATRADICARFSLADTPSARQWLENNHLDDNNECLLRRAIGADGRSR
FT                   GFINGTPVPVSQLRELGQHLIQIHGQHAHQLLLKPDHQKQLLDAYANQSSLLAEMKAAY
FT                   QIWHQSCRDLALHQQQSLERTARQELLQYQLKELNSFSPQAGEYEQIDIEYKRLANSGQ
FT                   LLSLSQQTLQLLSDDEQNNILSQLYAAKHQLTELASMDEQFNNLLNMLEEASIQISEAS
FT                   DELRHYAEQLDMDPNRLYELEKRLSRQLNLARKHHVAPEELPQFHQQLLDEQELLSQQE
FT                   NDHEQLSNAVNTHYQQALAIAKRLHQERQYYANELAALITESMHELSMPHGKFAIETIF
FT                   EPEHLSAEGATRIEFCVTTNPGQPLQALVKVASGGELSRIALAIQVITARKMDTPALIF
FT                   DEVDVGISGPTAAIVGRLLRQLGESTQVMCVTHLPQVAGCGHQHFFVSKQTDGTETETH
FT                   MHRLDKKARLQELARLLGGSEVTKNTLANAKELLAA"
     MLVQLTISNF AIVRELEIDF QPGMTAITGE TGAGKSIAVD ALGLCLGNRS DGSMVRLGAT        60
     RADICARFSL ADTPSARQWL ENNHLDDNNE CLLRRAIGAD GRSRGFINGT PVPVSQLREL       120
     GQHLIQIHGQ HAHQLLLKPD HQKQLLDAYA NQSSLLAEMK AAYQIWHQSC RDLALHQQQS       180
     LERTARQELL QYQLKELNSF SPQAGEYEQI DIEYKRLANS GQLLSLSQQT LQLLSDDEQN       240
     NILSQLYAAK HQLTELASMD EQFNNLLNML EEASIQISEA SDELRHYAEQ LDMDPNRLYE       300
     LEKRLSRQLN LARKHHVAPE ELPQFHQQLL DEQELLSQQE NDHEQLSNAV NTHYQQALAI       360
     AKRLHQERQY YANELAALIT ESMHELSMPH GKFAIETIFE PEHLSAEGAT RIEFCVTTNP       420
     GQPLQALVKV ASGGELSRIA LAIQVITARK MDTPALIFDE VDVGISGPTA AIVGRLLRQL       480
     GESTQVMCVT HLPQVAGCGH QHFFVSKQTD GTETETHMHR LDKKARLQEL ARLLGGSEVT       540
     KNTLANAKEL LAA                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page