(data stored in ACNUC9543 zone)

EMBL: CP000308.PE583

CP000308.PE583       Location/Qualifiers
FT   CDS             complement(666443..667324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12552"
FT                   /db_xref="GOA:A0A0H2Y5P1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y5P1"
FT                   /protein_id="ABG12552.1"
FT                   /translation="MNNRRFDCIGIVGHPRHPAALATHEILYHWLKARGYAVMVEQQIA
FT                   HDLNLTDAITGSLADIGQKADLAVVVGGDGNMLGAARVLARYDIKVIGVNRGNLGFLTD
FT                   LDPDNALQQLSDVLEGEYLSEQRFLLETHVRRTNQQSRISTAINEVVLHPGKVAHMIEF
FT                   EVYIDDRFAFSQRSDGLIIATPTGSTAYSLSAGGPILTPTLDAIVLVPMFPHTLTARPL
FT                   VISSSSTIRLKFSHITSDLEISCDSQIALPIQEGEEVLIRRSDFHLNLIHPKDYSYFNT
FT                   LSTKLGWSKKLF"
     MNNRRFDCIG IVGHPRHPAA LATHEILYHW LKARGYAVMV EQQIAHDLNL TDAITGSLAD        60
     IGQKADLAVV VGGDGNMLGA ARVLARYDIK VIGVNRGNLG FLTDLDPDNA LQQLSDVLEG       120
     EYLSEQRFLL ETHVRRTNQQ SRISTAINEV VLHPGKVAHM IEFEVYIDDR FAFSQRSDGL       180
     IIATPTGSTA YSLSAGGPIL TPTLDAIVLV PMFPHTLTAR PLVISSSSTI RLKFSHITSD       240
     LEISCDSQIA LPIQEGEEVL IRRSDFHLNL IHPKDYSYFN TLSTKLGWSK KLF              293
//

If you have problems or comments...

PBIL Back to PBIL home page