(data stored in ACNUC9543 zone)

EMBL: CP000308.PE584

CP000308.PE584       Location/Qualifiers
FT   CDS             667448..668026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0585"
FT                   /product="heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12553"
FT                   /db_xref="GOA:Q1CAG9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAG9"
FT                   /protein_id="ABG12553.1"
FT                   /translation="MSSKEQKTPNEQVSEEMENTAEQQVEATQETGECVDPRVAELEVQ
FT                   LSDALQRERESLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALDTA
FT                   DKTNTELISMIEGVELTLKSLLDAVGKFGIEVVGETHVPFNPEVHQAMTMLESADHEPN
FT                   HVMMVMQKGYTLNGRLLRPAMVAVSKAKS"
     MSSKEQKTPN EQVSEEMENT AEQQVEATQE TGECVDPRVA ELEVQLSDAL QRERESLLRA        60
     KAEVENIRRR TELDVEKAHK FALERFSSEL LPVIDNLERA LDTADKTNTE LISMIEGVEL       120
     TLKSLLDAVG KFGIEVVGET HVPFNPEVHQ AMTMLESADH EPNHVMMVMQ KGYTLNGRLL       180
     RPAMVAVSKA KS                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page