(data stored in ACNUC9543 zone)

EMBL: CP000308.PE586

CP000308.PE586       Location/Qualifiers
FT   CDS             670124..670513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0587"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12555"
FT                   /db_xref="GOA:A0A0H2Y4P9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4P9"
FT                   /protein_id="ABG12555.1"
FT                   /translation="MGKTVKKQRPVNLDLQTIRFPVTAIASILHRVSGVITFVAVGILL
FT                   WLLGLSVSSQEGFMQAATIMNSFFVKFIFWGILTALAYHICGGIRHLLMDFGYLEENLA
FT                   VGTRSAQVAMGLTLVLSVLAGVLVW"
     MGKTVKKQRP VNLDLQTIRF PVTAIASILH RVSGVITFVA VGILLWLLGL SVSSQEGFMQ        60
     AATIMNSFFV KFIFWGILTA LAYHICGGIR HLLMDFGYLE ENLAVGTRSA QVAMGLTLVL       120
     SVLAGVLVW                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page