(data stored in ACNUC9543 zone)

EMBL: CP000308.PE588

CP000308.PE588       Location/Qualifiers
FT   CDS             670855..672621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0589"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12557"
FT                   /db_xref="GOA:A0A0E1NT12"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT12"
FT                   /protein_id="ABG12557.1"
FT                   /translation="MNLPIREFDAVVVGAGGAGMRAALQISQMGLSCALISKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAVLELEHMGL
FT                   PFSRLEDGSIYQRPFGGQSLNFGGGQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAFVGCTAINIETGEVVYFKARATILATGGAGRIYQSTTNAHINTGDG
FT                   VGMALRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHV
FT                   DPIKEPIPVIPTCHYMMGGIPTKVTGQAITVNEKGEDVVIPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGMHLQESLMEQGASRDASESDIEASLARMNRWNNTRSGEDPVE
FT                   IRKALQACMQNNFSVFREGDAMAKGLEELKTIRERLQNARLDDTSSEFNTQRIECLELD
FT                   NLMETAFSTAVSANFRTESRGAHSRFDFPDRDDVNWLCHSLYLPGTESMTRREVNMQPK
FT                   LREAFPPKVRSY"
     MNLPIREFDA VVVGAGGAGM RAALQISQMG LSCALISKVF PTRSHTVSAQ GGITVALGNT        60
     HEDNWEWHMY DTVKGSDYIG DQDAIEYMCK TGPEAVLELE HMGLPFSRLE DGSIYQRPFG       120
     GQSLNFGGGQ AARTAAAADR TGHALLHTLY QQNLKNHTTI FSEWYALDLV KNQDGAFVGC       180
     TAINIETGEV VYFKARATIL ATGGAGRIYQ STTNAHINTG DGVGMALRAG VPVQDMEMWQ       240
     FHPTGIAGAG VLVTEGCRGE GGYLLNKHGE RFMERYAPNA KDLAGRDVVA RSIMIEIREG       300
     RGCDGPWGPH AKLKLDHLGK DVLESRLPGI LELSRTFAHV DPIKEPIPVI PTCHYMMGGI       360
     PTKVTGQAIT VNEKGEDVVI PGLFAVGEIA CVSVHGANRL GGNSLLDLVV FGRAAGMHLQ       420
     ESLMEQGASR DASESDIEAS LARMNRWNNT RSGEDPVEIR KALQACMQNN FSVFREGDAM       480
     AKGLEELKTI RERLQNARLD DTSSEFNTQR IECLELDNLM ETAFSTAVSA NFRTESRGAH       540
     SRFDFPDRDD VNWLCHSLYL PGTESMTRRE VNMQPKLREA FPPKVRSY                    588
//

If you have problems or comments...

PBIL Back to PBIL home page