(data stored in ACNUC9543 zone)

EMBL: CP000308.PE589

CP000308.PE589       Location/Qualifiers
FT   CDS             672671..673387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0590"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12558"
FT                   /db_xref="GOA:A0A0E1NND6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NND6"
FT                   /protein_id="ABG12558.1"
FT                   /translation="MKLEFSIYRYNPDVDNAPHMQDYTLDAEEGRDMMLLDALIQLKEK
FT                   DPTLSFRRSCREGVCGSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLV
FT                   VDMGQFYTQYEKIKPYLLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFVGPAGLLAAYRFLIDSRDTETASRLDDLDDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TKAIGHIKSMLLQRSA"
     MKLEFSIYRY NPDVDNAPHM QDYTLDAEEG RDMMLLDALI QLKEKDPTLS FRRSCREGVC        60
     GSDGLNMNGK NGLACITPIS ALQKGNKKIV IRPLPGLPVV RDLVVDMGQF YTQYEKIKPY       120
     LLNDGKNPPA REHLQSPEQR AKLDGLYECI LCACCSTSCP SFWWNPDKFV GPAGLLAAYR       180
     FLIDSRDTET ASRLDDLDDA FSVFRCHSIM NCVSVCPKGL NPTKAIGHIK SMLLQRSA         238
//

If you have problems or comments...

PBIL Back to PBIL home page