(data stored in ACNUC9543 zone)

EMBL: CP000308.PE592

CP000308.PE592       Location/Qualifiers
FT   CDS             677916..679082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0593"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12561"
FT                   /db_xref="GOA:Q1CAG1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAG1"
FT                   /protein_id="ABG12561.1"
FT                   /translation="MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDI
FT                   DKELYLGAVIDRSSRRVVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGREL
FT                   AFKLGLTGKQVGQFTKIFMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNA
FT                   LFRQPELREMRDPSQEDAREAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAATSLTDAAQQVVAAVGAK"
     MNLHEYQAKQ LFARYGMPAP TGYACTTPRE AEEAASKIGA GPWVVKCQVH AGGRGKAGGV        60
     KLVNSKEDIR AFAEQWLGKK LVTYQTDANG QPVHQILVEA ATDIDKELYL GAVIDRSSRR       120
     VVFMASTEGG VEIEKVAEET PELIHKIALD PLTGPQPYQG RELAFKLGLT GKQVGQFTKI       180
     FMGLATLFLE RDLAMVEINP LVVTKQGDLI CLDGKLGADG NALFRQPELR EMRDPSQEDA       240
     REAHAAQWEL NYVALDGNIG CMVNGAGLAM GTMDIVKLHG GEPANFLDVG GGATKERVTE       300
     AFKIILSDDK VKAVFVNIFG GIVRCDLIAD GIIGAVEEVG VNVPVVVRLE GNNAELGAKK       360
     LADSGLNIIA ATSLTDAAQQ VVAAVGAK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page