(data stored in ACNUC9543 zone)

EMBL: CP000308.PE593

CP000308.PE593       Location/Qualifiers
FT   CDS             679082..679954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0594"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12562"
FT                   /db_xref="GOA:A0A0E1NVT3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVT3"
FT                   /protein_id="ABG12562.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TQHLGLPVFNTVREAVETTGATASVIYVPAPFCKDSILEAIDAGIKLIICITEGIPTLD
FT                   MLVVKVRLEQSDARMIGPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVK
FT                   QTTDIGFGQSSCVGIGGDPIPGSNFIDILKLFQEDPQTEVIVMIGEIGGNAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADDKFAALEAAGVKTVRSLAEIG
FT                   NAVKAVLPQ"
     MSILIDKNTK VICQGFTGSQ GTFHSEQAIA YGTKMVGGVT PGKGGTQHLG LPVFNTVREA        60
     VETTGATASV IYVPAPFCKD SILEAIDAGI KLIICITEGI PTLDMLVVKV RLEQSDARMI       120
     GPNCPGVITP GECKIGIMPG HIHLPGKVGI VSRSGTLTYE AVKQTTDIGF GQSSCVGIGG       180
     DPIPGSNFID ILKLFQEDPQ TEVIVMIGEI GGNAEEEAAA YIKEHVTKPV VGYIAGVTAP       240
     KGKRMGHAGA IIAGGKGTAD DKFAALEAAG VKTVRSLAEI GNAVKAVLPQ                  290
//

If you have problems or comments...

PBIL Back to PBIL home page