(data stored in ACNUC9543 zone)

EMBL: CP000308.PE594

CP000308.PE594       Location/Qualifiers
FT   CDS             680721..682289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0595"
FT                   /product="cytochrome D ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12563"
FT                   /db_xref="GOA:A0A0E1NLF7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF7"
FT                   /protein_id="ABG12563.1"
FT                   /translation="MFDIVELSRLQFALTAMYHFLFVPLTLGLAFLLAIMESVYVLSGK
FT                   QIYKDMTKFWGKLFAINFALGVATGLTMEFQFGTNWSYFSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFVGLFFFGWDRLTKHQHLAVTWLVALGSNFSALWILVANGWMQNPIASDFNFET
FT                   MRMEMLSFSELVLNPVAQVKFVHTVAAGYVTGAMFILGISSYYLLKGRDIPFAKRSFAI
FT                   AASFGLASVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPPPAAFTLFAIPNQETME
FT                   NRFAIQIPYALGLIATRSLDTPVIGLRDLMSQHEVRIRNGIQAYSLLEQLRGGNTDPAV
FT                   RDAFNKAKQDLGYGMLLKRYTENVADATEEQIQLAAQDSIPRVLPLYFAFRIMVACGFL
FT                   MLLIIGLAFYNVVRGRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLP
FT                   TAVANSSVTAGEILFSMALICGLYTLFLIAEMYLMFKFARLGPSSLKTGRYHFEQPTAP
FT                   VQEAR"
     MFDIVELSRL QFALTAMYHF LFVPLTLGLA FLLAIMESVY VLSGKQIYKD MTKFWGKLFA        60
     INFALGVATG LTMEFQFGTN WSYFSHYVGD IFGAPLAIEG LMAFFLESTF VGLFFFGWDR       120
     LTKHQHLAVT WLVALGSNFS ALWILVANGW MQNPIASDFN FETMRMEMLS FSELVLNPVA       180
     QVKFVHTVAA GYVTGAMFIL GISSYYLLKG RDIPFAKRSF AIAASFGLAS VLSVIVLGDE       240
     SGYEMGDVQK TKLAAIEAEW ETQPPPAAFT LFAIPNQETM ENRFAIQIPY ALGLIATRSL       300
     DTPVIGLRDL MSQHEVRIRN GIQAYSLLEQ LRGGNTDPAV RDAFNKAKQD LGYGMLLKRY       360
     TENVADATEE QIQLAAQDSI PRVLPLYFAF RIMVACGFLM LLIIGLAFYN VVRGRIGEKK       420
     WLLRAALYGI PLPWIAVEAG WFVAEYGRQP WAIGEVLPTA VANSSVTAGE ILFSMALICG       480
     LYTLFLIAEM YLMFKFARLG PSSLKTGRYH FEQPTAPVQE AR                          522
//

If you have problems or comments...

PBIL Back to PBIL home page