(data stored in ACNUC9543 zone)

EMBL: CP000308.PE595

CP000308.PE595       Location/Qualifiers
FT   CDS             682304..683443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0596"
FT                   /product="cytochrome D ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12564"
FT                   /db_xref="GOA:A0A0E1NPX6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPX6"
FT                   /protein_id="ABG12564.1"
FT                   /translation="MFDYEVLRFIWWLLIGVLLIGFAVTDGFDMGVGILLRIIGKNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYIAMILVLAALFFRPVGF
FT                   DYRSKLEDSRWRNMWDWGIFIGSFVPAVVFGVAFGNLLQGVPFHMNEYMRLFYTGNFFQ
FT                   LLNPFGLLAGIVSLTMLVTQGATYLQMRTRGELHLRSRKAAQISALVMSVAFLLAGIWL
FT                   VKGIDGFVITSVLDTAAESNPMRKEVAHQAGAWLINFNKYPILWALPALGVILPLFTIL
FT                   LSRFEKGAWAFLFSSLTIACVILTAGVTMFPFVMPSSTMPNVSLTMWDATSSLLTLKVM
FT                   TIVAIIFVPIILLYTSWCYYKMFGRIDKEFIENNKHSLY"
     MFDYEVLRFI WWLLIGVLLI GFAVTDGFDM GVGILLRIIG KNDTERRIMI NSIAPHWDGN        60
     QVWLITAGGA LFAAWPMVYA AAFSGFYIAM ILVLAALFFR PVGFDYRSKL EDSRWRNMWD       120
     WGIFIGSFVP AVVFGVAFGN LLQGVPFHMN EYMRLFYTGN FFQLLNPFGL LAGIVSLTML       180
     VTQGATYLQM RTRGELHLRS RKAAQISALV MSVAFLLAGI WLVKGIDGFV ITSVLDTAAE       240
     SNPMRKEVAH QAGAWLINFN KYPILWALPA LGVILPLFTI LLSRFEKGAW AFLFSSLTIA       300
     CVILTAGVTM FPFVMPSSTM PNVSLTMWDA TSSLLTLKVM TIVAIIFVPI ILLYTSWCYY       360
     KMFGRIDKEF IENNKHSLY                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page