(data stored in ACNUC9543 zone)

EMBL: CP000308.PE596

CP000308.PE596       Location/Qualifiers
FT   CDS             683535..683867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12565"
FT                   /db_xref="GOA:A0A0H2Y3I4"
FT                   /db_xref="InterPro:IPR011846"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3I4"
FT                   /protein_id="ABG12565.1"
FT                   /translation="MKPTQQLKPLTMATTMLSDKLYELMDKGPLRALSLVLAFALAFCV
FT                   FWDPTRFAAATSSLEVWQEVFIVWAVCTGVIHGVGFRPKQVWLRAFFAPLPAIVILATG
FT                   LFYFFA"
     MKPTQQLKPL TMATTMLSDK LYELMDKGPL RALSLVLAFA LAFCVFWDPT RFAAATSSLE        60
     VWQEVFIVWA VCTGVIHGVG FRPKQVWLRA FFAPLPAIVI LATGLFYFFA                  110
//

If you have problems or comments...

PBIL Back to PBIL home page