(data stored in ACNUC9543 zone)

EMBL: CP000308.PE601

CP000308.PE601       Location/Qualifiers
FT   CDS             686925..688217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0602"
FT                   /product="TolB colicin import protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12570"
FT                   /db_xref="GOA:Q1CAF2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CAF2"
FT                   /protein_id="ABG12570.1"
FT                   /translation="MKQAFRVALGFLVLWASVLHAEVRIEITQGVDSARPIGVVPFKWM
FT                   GPGTPPEEIGAIVGADLRNSGKFNPIDAARMPQQPSTAAEVTPAAWTALGIDAVVVGQV
FT                   QPSADGSYVVSYQLVDTSGSAGSILAQNQYKVTKQWLRYSAHTVSDEVFEKLTGIKGAF
FT                   RTRIAYVVKTNGGKFPHELRVSDYDGYNQFVVHRSPEPLMSPAWSPDGSKIAYVTFESG
FT                   KSALVIQTLANGAIRQVASFPRHNGAPAFSPDGTKLAFALSKSGSLNLYVMDLASGQIS
FT                   QVTDGRSNNTEPSWFPDSQNLAYTSDQGGRPQVYKVNINGGVPQRITWEGSQNQNADVS
FT                   PDGKFLVLVSSNGGAQHIAKQDLETGAVQVLTDTLLDETPSIAPNGTMVIYSSTQGLGS
FT                   VLQLVSTDGRFKARLPATDGQVKFPAWSPYL"
     MKQAFRVALG FLVLWASVLH AEVRIEITQG VDSARPIGVV PFKWMGPGTP PEEIGAIVGA        60
     DLRNSGKFNP IDAARMPQQP STAAEVTPAA WTALGIDAVV VGQVQPSADG SYVVSYQLVD       120
     TSGSAGSILA QNQYKVTKQW LRYSAHTVSD EVFEKLTGIK GAFRTRIAYV VKTNGGKFPH       180
     ELRVSDYDGY NQFVVHRSPE PLMSPAWSPD GSKIAYVTFE SGKSALVIQT LANGAIRQVA       240
     SFPRHNGAPA FSPDGTKLAF ALSKSGSLNL YVMDLASGQI SQVTDGRSNN TEPSWFPDSQ       300
     NLAYTSDQGG RPQVYKVNIN GGVPQRITWE GSQNQNADVS PDGKFLVLVS SNGGAQHIAK       360
     QDLETGAVQV LTDTLLDETP SIAPNGTMVI YSSTQGLGSV LQLVSTDGRF KARLPATDGQ       420
     VKFPAWSPYL                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page