(data stored in ACNUC9543 zone)

EMBL: CP000308.PE605

CP000308.PE605       Location/Qualifiers
FT   CDS             691612..692337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0606"
FT                   /product="intergral membrane NMN transport protein PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12574"
FT                   /db_xref="GOA:A0A0E1NPW0"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPW0"
FT                   /protein_id="ABG12574.1"
FT                   /translation="MDFLSTGNILVHIPLGAGGYDLSWIEAIGTLFGLLCIWFASKEKI
FT                   INYLFGLINVTLFAVIFFQIQLYASLLLQLFFFGANIYGWYAWSKQTPDNQAELKIRWL
FT                   SLPKALAWAAVCIAGIVLMTLHIDTVFAWLTRVAVTVMQSLGANVQMPELQPDAFPFWD
FT                   STMMVLSIAAMILMTRKYVENWLIWVVIDVISVAIFAYQGVYAMALEYAFLTLIALNGS
FT                   WLWIKSAARNHSRPLSTQG"
     MDFLSTGNIL VHIPLGAGGY DLSWIEAIGT LFGLLCIWFA SKEKIINYLF GLINVTLFAV        60
     IFFQIQLYAS LLLQLFFFGA NIYGWYAWSK QTPDNQAELK IRWLSLPKAL AWAAVCIAGI       120
     VLMTLHIDTV FAWLTRVAVT VMQSLGANVQ MPELQPDAFP FWDSTMMVLS IAAMILMTRK       180
     YVENWLIWVV IDVISVAIFA YQGVYAMALE YAFLTLIALN GSWLWIKSAA RNHSRPLSTQ       240
     G                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page