(data stored in ACNUC9543 zone)

EMBL: CP000308.PE606

CP000308.PE606       Location/Qualifiers
FT   CDS             complement(692452..693390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0607"
FT                   /product="putative cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12575"
FT                   /db_xref="GOA:A0A0E1NT53"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023500"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NT53"
FT                   /protein_id="ABG12575.1"
FT                   /translation="MAVSTIFSQDSNSKRLLIAFAITTLFMVTEAIGGWLSGSLALLAD
FT                   AGHMLTDSAALFIALMAVHFSQRKPDPRHTFGYLRLTTLAAFVNAAALLLIVILIVWEA
FT                   VHRFFSPHEVMGTPMLIIAIAGLLANIFCFWILHKGEEEKNINVRAAALHVLSDLLGSV
FT                   GAMIAAIVILTTGWTPIDPILSVLVSVLILRSAWRLLKESFHELLEGAPQEIDINKLRK
FT                   DLCTNIYEVRNIHHVHLWQVGEQRLMTLHAQVIPPLDHDALLQRIQDYLLHHYRISHAT
FT                   VQMEYQHCGTPDCGINQAAPADGHHRHHHHE"
     MAVSTIFSQD SNSKRLLIAF AITTLFMVTE AIGGWLSGSL ALLADAGHML TDSAALFIAL        60
     MAVHFSQRKP DPRHTFGYLR LTTLAAFVNA AALLLIVILI VWEAVHRFFS PHEVMGTPML       120
     IIAIAGLLAN IFCFWILHKG EEEKNINVRA AALHVLSDLL GSVGAMIAAI VILTTGWTPI       180
     DPILSVLVSV LILRSAWRLL KESFHELLEG APQEIDINKL RKDLCTNIYE VRNIHHVHLW       240
     QVGEQRLMTL HAQVIPPLDH DALLQRIQDY LLHHYRISHA TVQMEYQHCG TPDCGINQAA       300
     PADGHHRHHH HE                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page