(data stored in ACNUC9543 zone)

EMBL: CP000308.PE615

CP000308.PE615       Location/Qualifiers
FT   CDS             complement(702656..703471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0616"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12584"
FT                   /db_xref="GOA:A0A0H2Y4S4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4S4"
FT                   /protein_id="ABG12584.1"
FT                   /translation="MITVPLFATSASGHTVKISKTTRQASTGPSTLNNRSTVPTIKTIS
FT                   LYSLPLSFYFWQVFGLLLVGLLFLALSRSEQLDWLISNYWFDPVGQNFPWEHNKWLDLL
FT                   NHRLLKMALIATAIAALLWGIYRRNGRLVTTALLFGLGPLVIGILKATSAHSCPWDLVE
FT                   YGGKALNYVLMDTAPPGAGPGHCFPGGHASSGFAVMALFFLFYPERPRLAMLCWFAGIG
FT                   LGMLMGFGQIMRGAHFLTHNLWAGWWVWLSQLAAFWIISGYYQRIKGTE"
     MITVPLFATS ASGHTVKISK TTRQASTGPS TLNNRSTVPT IKTISLYSLP LSFYFWQVFG        60
     LLLVGLLFLA LSRSEQLDWL ISNYWFDPVG QNFPWEHNKW LDLLNHRLLK MALIATAIAA       120
     LLWGIYRRNG RLVTTALLFG LGPLVIGILK ATSAHSCPWD LVEYGGKALN YVLMDTAPPG       180
     AGPGHCFPGG HASSGFAVMA LFFLFYPERP RLAMLCWFAG IGLGMLMGFG QIMRGAHFLT       240
     HNLWAGWWVW LSQLAAFWII SGYYQRIKGT E                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page