(data stored in ACNUC9543 zone)

EMBL: CP000308.PE619

CP000308.PE619       Location/Qualifiers
FT   CDS             707084..707569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12588"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUU0"
FT                   /protein_id="ABG12588.1"
FT                   /translation="MDSLIVPDLALLRRWLDQLGISFFECDSCQALHLPHMQNFEGVFD
FT                   AKIDLVDNIILFSALAEVRPTALIPLVADLSQINASSLTVKAFIDIQDDNLPKLIVCQS
FT                   LVVEVGVTIEQFGYFMQQCEEQISMIIMEARANDLLFIGNNDEEEAPLTATSYPIIH"
     MDSLIVPDLA LLRRWLDQLG ISFFECDSCQ ALHLPHMQNF EGVFDAKIDL VDNIILFSAL        60
     AEVRPTALIP LVADLSQINA SSLTVKAFID IQDDNLPKLI VCQSLVVEVG VTIEQFGYFM       120
     QQCEEQISMI IMEARANDLL FIGNNDEEEA PLTATSYPII H                           161
//

If you have problems or comments...

PBIL Back to PBIL home page