(data stored in ACNUC9543 zone)

EMBL: CP000308.PE62

CP000308.PE62        Location/Qualifiers
FT   CDS             complement(77824..78135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0062"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12031"
FT                   /db_xref="GOA:Q1CBZ1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBZ1"
FT                   /protein_id="ABG12031.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETIEFDQVLMIANGE
FT                   EINIGAPLVDGGKIKAEIIAHGRGEKIKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
     MYAVFQSGGK QHRVSEGQTI RLEKLDIATG ETIEFDQVLM IANGEEINIG APLVDGGKIK        60
     AEIIAHGRGE KIKIVKFRRR KHYRKQQGHR QWFTDVKITG ISA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page