(data stored in ACNUC9543 zone)

EMBL: CP000308.PE621

CP000308.PE621       Location/Qualifiers
FT   CDS             709367..710500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0622"
FT                   /product="putrescine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12590"
FT                   /db_xref="GOA:A0A0E1NVW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVW8"
FT                   /protein_id="ABG12590.1"
FT                   /translation="MNDVIPRPQPKSQKVFTPLLEIRNLTKSFDGQAAVDDVNLTIYKG
FT                   EIFALLGASGCGKSTLLRMLAGFEQPTQGQIVLDGQDLSHVPPYRRPINMMFQSYALFP
FT                   HMTVEQNIAFGLKQDKLPSNEIKSRVAEMLTLVHMQEFAKRKPHQLSGGQRQRVALARS
FT                   LAKRPKLLLLDEPMGALDKKLRDRMQLEVLDILERVGATCVMVTHDQEEAMTMAGRIAI
FT                   MNRGKFVQIGEPEEIYEHPNSRFSAEFIGSVNVFEGVLKERLDDALVIDSPGLRHPLKV
FT                   DSDASVVDGVPVLVALRPEKVMLCDQVPKDGCNFAVGEVVHIAYLGDLSIYHVKLHSGQ
FT                   MLSAQLQNGHRYRKGMPTWGDEVQLCWDADSCVVLGS"
     MNDVIPRPQP KSQKVFTPLL EIRNLTKSFD GQAAVDDVNL TIYKGEIFAL LGASGCGKST        60
     LLRMLAGFEQ PTQGQIVLDG QDLSHVPPYR RPINMMFQSY ALFPHMTVEQ NIAFGLKQDK       120
     LPSNEIKSRV AEMLTLVHMQ EFAKRKPHQL SGGQRQRVAL ARSLAKRPKL LLLDEPMGAL       180
     DKKLRDRMQL EVLDILERVG ATCVMVTHDQ EEAMTMAGRI AIMNRGKFVQ IGEPEEIYEH       240
     PNSRFSAEFI GSVNVFEGVL KERLDDALVI DSPGLRHPLK VDSDASVVDG VPVLVALRPE       300
     KVMLCDQVPK DGCNFAVGEV VHIAYLGDLS IYHVKLHSGQ MLSAQLQNGH RYRKGMPTWG       360
     DEVQLCWDAD SCVVLGS                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page