(data stored in ACNUC9543 zone)

EMBL: CP000308.PE624

CP000308.PE624       Location/Qualifiers
FT   CDS             712457..712921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0625"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12593"
FT                   /db_xref="InterPro:IPR019703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX17"
FT                   /protein_id="ABG12593.1"
FT                   /translation="MRPSFSSSAATPVPVVIGGTAIIATRIIGVLLLVAELGFSGVSDF
FT                   ISDSLQRWDTGLIFFASIVLLLLDMMCGVAVCHRRNWARWYYLICQLIIMIYLLMASLN
FT                   WLEPDIFRIEGDSGAEILHSLLLQKIPDVVIIGLLFFPWHRYFPQSKMSV"
     MRPSFSSSAA TPVPVVIGGT AIIATRIIGV LLLVAELGFS GVSDFISDSL QRWDTGLIFF        60
     ASIVLLLLDM MCGVAVCHRR NWARWYYLIC QLIIMIYLLM ASLNWLEPDI FRIEGDSGAE       120
     ILHSLLLQKI PDVVIIGLLF FPWHRYFPQS KMSV                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page