(data stored in ACNUC9543 zone)

EMBL: CP000308.PE626

CP000308.PE626       Location/Qualifiers
FT   CDS             complement(714262..714993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12595"
FT                   /db_xref="GOA:A0A0E1P0W2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0W2"
FT                   /protein_id="ABG12595.1"
FT                   /translation="MKKLLLATLLSGMAFSATAAETLRFAASATYPPFESMDANNEIVG
FT                   FDMDLAKALCKQMEANCTFTNQAFDSLIPALKFKRYDAVISGMDITPERSKQVAFTQPY
FT                   YANSAIVIAPKGKFSTFADLKGKKIGMENGTTHQKYLQDKHPEIQTVSYDSYQNAIIDL
FT                   KNGRIDGVFGDTAVVNEWLKTNPNLASVGEHVTDPQYFGTGLGIAVRPDNIALLTKLNK
FT                   AIDAVKADGTYQAINDKWFPQ"
     MKKLLLATLL SGMAFSATAA ETLRFAASAT YPPFESMDAN NEIVGFDMDL AKALCKQMEA        60
     NCTFTNQAFD SLIPALKFKR YDAVISGMDI TPERSKQVAF TQPYYANSAI VIAPKGKFST       120
     FADLKGKKIG MENGTTHQKY LQDKHPEIQT VSYDSYQNAI IDLKNGRIDG VFGDTAVVNE       180
     WLKTNPNLAS VGEHVTDPQY FGTGLGIAVR PDNIALLTKL NKAIDAVKAD GTYQAINDKW       240
     FPQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page