(data stored in ACNUC9543 zone)

EMBL: CP000308.PE628

CP000308.PE628       Location/Qualifiers
FT   CDS             717150..718241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0629"
FT                   /product="putative periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12597"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW30"
FT                   /protein_id="ABG12597.1"
FT                   /translation="MLLRIFWSLCLWWGISSSALAEIHLKDVDGREVTLAAPAQRVYIG
FT                   FYYEDFLAINGPDSYQHVVAFSKSDWSLRTSQWPRYQAALRRLSQLVDVGSLYNQSFDF
FT                   ERLLATRPDLLILAKWQLEGFANYLPVLQQLSIPYVVVDFNQGEDAKLTSIRVMGQALG
FT                   HGERAERLAIAYQQGIADIRRRITQANLPSPKTYIELGDKGPGEYSSSYGSSIWGPLLQ
FT                   QAGANNIATGVVTTPSPLRAEYVLSQKPEVIFLAGGDWPKMPNAVSMGFGAKPETLQQS
FT                   MTQYAQRPGWSQFPAIKQTRFYALYHGGVRTLYDYIFVQFVAKALFPSAFEDVNPQHNL
FT                   ETFYEEYLPIKADGVFMQQWQGE"
     MLLRIFWSLC LWWGISSSAL AEIHLKDVDG REVTLAAPAQ RVYIGFYYED FLAINGPDSY        60
     QHVVAFSKSD WSLRTSQWPR YQAALRRLSQ LVDVGSLYNQ SFDFERLLAT RPDLLILAKW       120
     QLEGFANYLP VLQQLSIPYV VVDFNQGEDA KLTSIRVMGQ ALGHGERAER LAIAYQQGIA       180
     DIRRRITQAN LPSPKTYIEL GDKGPGEYSS SYGSSIWGPL LQQAGANNIA TGVVTTPSPL       240
     RAEYVLSQKP EVIFLAGGDW PKMPNAVSMG FGAKPETLQQ SMTQYAQRPG WSQFPAIKQT       300
     RFYALYHGGV RTLYDYIFVQ FVAKALFPSA FEDVNPQHNL ETFYEEYLPI KADGVFMQQW       360
     QGE                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page