(data stored in ACNUC9543 zone)

EMBL: CP000308.PE630

CP000308.PE630       Location/Qualifiers
FT   CDS             719294..720079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0631"
FT                   /product="putative transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12599"
FT                   /db_xref="GOA:A0A0E1NM00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM00"
FT                   /protein_id="ABG12599.1"
FT                   /translation="MTQLTLKHVGVTLHKRPLLTDISLTWPAAQVSGIIGPNGAGKSTL
FT                   LKAINHMVPITGQIEYQQCPLNTRVTRIAYVSQLNRSDSALTVFEMVLLGKVRQLSWRV
FT                   SPAQIDAVEQVLAECGISSLANQVFNSLSGGQRQLVMLAQAFIAQPQIILLDEPTSALD
FT                   IHHQLRVLQKIVDYSKRHQCTTLMVIHDLGLALRFCQTLTLIHRGNVACHGAAHQVIAD
FT                   PMMSTVFGVGIESGTSPLGYRYLLPTQFLPTHGEKICIR"
     MTQLTLKHVG VTLHKRPLLT DISLTWPAAQ VSGIIGPNGA GKSTLLKAIN HMVPITGQIE        60
     YQQCPLNTRV TRIAYVSQLN RSDSALTVFE MVLLGKVRQL SWRVSPAQID AVEQVLAECG       120
     ISSLANQVFN SLSGGQRQLV MLAQAFIAQP QIILLDEPTS ALDIHHQLRV LQKIVDYSKR       180
     HQCTTLMVIH DLGLALRFCQ TLTLIHRGNV ACHGAAHQVI ADPMMSTVFG VGIESGTSPL       240
     GYRYLLPTQF LPTHGEKICI R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page