(data stored in ACNUC9543 zone)

EMBL: CP000308.PE633

CP000308.PE633       Location/Qualifiers
FT   CDS             722224..723069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0634"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12602"
FT                   /db_xref="GOA:A0A0E1NLX6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLX6"
FT                   /protein_id="ABG12602.1"
FT                   /translation="MNQGALLAILASLIFSVMNVLVKTIADEIPTGEIVFFRSSIGCLL
FT                   IGLLMYQRGIAFSREDRPLLVLRGTMGALYLICYFYSIAHLTLADASMLAYLSPFFSIV
FT                   LSLLVLRERVNATMAFWLVMVIIGAIILIRPWNFSTYTLASLVGVMSAVFAAIAYLSVN
FT                   KLTKRHHNYEIVFYFLFITTLISIPLMWHNFVWPSGYQFGILIAIALVSLLGQVVLTQA
FT                   FSSDNLIVVSVVRYIGIVFNITWGWLFWDEVPLMLSLMGGGLVVVSCIQLGLRSKKKAA
FT                   "
     MNQGALLAIL ASLIFSVMNV LVKTIADEIP TGEIVFFRSS IGCLLIGLLM YQRGIAFSRE        60
     DRPLLVLRGT MGALYLICYF YSIAHLTLAD ASMLAYLSPF FSIVLSLLVL RERVNATMAF       120
     WLVMVIIGAI ILIRPWNFST YTLASLVGVM SAVFAAIAYL SVNKLTKRHH NYEIVFYFLF       180
     ITTLISIPLM WHNFVWPSGY QFGILIAIAL VSLLGQVVLT QAFSSDNLIV VSVVRYIGIV       240
     FNITWGWLFW DEVPLMLSLM GGGLVVVSCI QLGLRSKKKA A                           281
//

If you have problems or comments...

PBIL Back to PBIL home page