(data stored in ACNUC9543 zone)

EMBL: CP000308.PE634

CP000308.PE634       Location/Qualifiers
FT   CDS             complement(723094..723243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0635"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12603"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4G1"
FT                   /protein_id="ABG12603.1"
FT                   /translation="MRQRRIINQKLRDDPVSLTPRPCDLPYLTVMLQAAYALAAFLPLE
FT                   LFGV"
     MRQRRIINQK LRDDPVSLTP RPCDLPYLTV MLQAAYALAA FLPLELFGV                    49
//

If you have problems or comments...

PBIL Back to PBIL home page