(data stored in ACNUC9543 zone)

EMBL: CP000308.PE635

CP000308.PE635       Location/Qualifiers
FT   CDS             complement(723259..723927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0636"
FT                   /product="arginine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12604"
FT                   /db_xref="GOA:A0A0E1NN66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN66"
FT                   /protein_id="ABG12604.1"
FT                   /translation="MLEYIPEILKGLHTSLTLTIVSLLVALVLSVVFTIVLTLKTPIAT
FT                   PLVKIYITLFTGTPLLVQIFLIYYGPGQFPAIREYPWLWSLLSQPWLCAMIALALNSAA
FT                   YTTQLFYGAVRAIPSGQWQSCEALGMSKRQSLRILLPFAFKRALSSYSNEVVLVFKGTS
FT                   LAYTITLMEVMGYSQLMYGRTYDVMVFGAAGVVYLCVNGLLTLLMRLVERKALAFERRN
FT                   "
     MLEYIPEILK GLHTSLTLTI VSLLVALVLS VVFTIVLTLK TPIATPLVKI YITLFTGTPL        60
     LVQIFLIYYG PGQFPAIREY PWLWSLLSQP WLCAMIALAL NSAAYTTQLF YGAVRAIPSG       120
     QWQSCEALGM SKRQSLRILL PFAFKRALSS YSNEVVLVFK GTSLAYTITL MEVMGYSQLM       180
     YGRTYDVMVF GAAGVVYLCV NGLLTLLMRL VERKALAFER RN                          222
//

If you have problems or comments...

PBIL Back to PBIL home page