(data stored in ACNUC9543 zone)

EMBL: CP000308.PE637

CP000308.PE637       Location/Qualifiers
FT   CDS             complement(724655..725386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0638"
FT                   /product="arginine-binding periplasmic protein 1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12606"
FT                   /db_xref="GOA:A0A0E1NUM0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUM0"
FT                   /protein_id="ABG12606.1"
FT                   /translation="MKKLIIATVLASISLSASAAETIRFAAEATYPPFEFIDANNKMQG
FT                   FDIDLANALCKEMQADCTFTNQAFDSLIPSLKFKRFDAVISGMDITPERQKQVAFTQPY
FT                   YDNSALFIAQKDKVADLAALKGKRVGMQNGSTHQKYLMEKHPEITAVPYDSYQNAILDL
FT                   KNGRLDAVFGDTAVVNEWLKQNDQLAAVGDKVTDADYFGTGLGIAVRQSNTELQGKLDA
FT                   ALTKVKADGTYQTIYKKWFQQ"
     MKKLIIATVL ASISLSASAA ETIRFAAEAT YPPFEFIDAN NKMQGFDIDL ANALCKEMQA        60
     DCTFTNQAFD SLIPSLKFKR FDAVISGMDI TPERQKQVAF TQPYYDNSAL FIAQKDKVAD       120
     LAALKGKRVG MQNGSTHQKY LMEKHPEITA VPYDSYQNAI LDLKNGRLDA VFGDTAVVNE       180
     WLKQNDQLAA VGDKVTDADY FGTGLGIAVR QSNTELQGKL DAALTKVKAD GTYQTIYKKW       240
     FQQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page