(data stored in ACNUC9543 zone)

EMBL: CP000308.PE64

CP000308.PE64        Location/Qualifiers
FT   CDS             complement(79463..79810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12033"
FT                   /db_xref="GOA:A0A0E1NMA0"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMA0"
FT                   /protein_id="ABG12033.1"
FT                   /translation="MKKEWFAAKELAGLEGLPSSPQGINLMAKREGWEQRRRRGVQGKA
FT                   VEYHIGSLPITILNSLQLREEPAQYATTRQDPLTLWVEAYYRFTEAEREQVISFIFREG
FT                   AKSLIERLEMD"
     MKKEWFAAKE LAGLEGLPSS PQGINLMAKR EGWEQRRRRG VQGKAVEYHI GSLPITILNS        60
     LQLREEPAQY ATTRQDPLTL WVEAYYRFTE AEREQVISFI FREGAKSLIE RLEMD            115
//

If you have problems or comments...

PBIL Back to PBIL home page