(data stored in ACNUC9543 zone)

EMBL: CP000308.PE68

CP000308.PE68        Location/Qualifiers
FT   CDS             82964..83227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12037"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYN5"
FT                   /protein_id="ABG12037.1"
FT                   /translation="MNIKTTVATMSILSALSFGVFAADSINENQATQLQPMGTITVSGL
FT                   NGAPSDIRQALSDKADTVGAKAYKVIEVRSENNWHATANIYK"
     MNIKTTVATM SILSALSFGV FAADSINENQ ATQLQPMGTI TVSGLNGAPS DIRQALSDKA        60
     DTVGAKAYKV IEVRSENNWH ATANIYK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page