(data stored in ACNUC9543 zone)

EMBL: CP000308.PE73

CP000308.PE73        Location/Qualifiers
FT   CDS             complement(87293..91210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12042"
FT                   /db_xref="GOA:A0A0E1NSK0"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSK0"
FT                   /protein_id="ABG12042.1"
FT                   /translation="MKWVKRLSIAFLLIILLLVGALGGLLGTTSGLHFLINSAARWVPG
FT                   LDIASVSGGWRGLTLTGIQYQMPGVTVKAGQFYLSLQLSCLKNSELCVNALTAQDIDVV
FT                   VNTQAMPPTSSTPASTDPMGELSTPYPIFLRLLSLNNVKVTIDDTAISLDEFRTGAHWK
FT                   QRSLALMPTKINGLLIALPKTVSAGVPDAVKPAVETAMAAKEAVAQLSAAPGRSATASG
FT                   QSTTASGRSATASGQSATTGGQLATVPAEPATPLGESLKALFAKPLLPALPDFRLPLDL
FT                   QIEEISGQQLRLTGDNEVLISSLLLQASTQDQRITLDTLEIKSPQGGLSAQGQATLADK
FT                   WPLDLVVNSALNIDSLKGEKVKLTVGGALREELKVTLNLSGPVSAQLETETSLAKAGLP
FT                   LSLTLQSKQLRWPLTGEPQYQMNNLRMRLNGQATDYALSIRSDIKGTDLPPAVFTLEGK
FT                   GNVEQFNLTRLRLAALQGHTDLTGVVDWRQAISWNSVLTLSGINMAKQWPEWPAKLEGK
FT                   IVTRGSIHGGSWQLQVPELVLDGNVKQNRVTARGSLTGNAAGQWHIPGINLALGRNKLD
FT                   MKGELNDNWLLDANVDAPQLDGALPGLGGVVKGSLKLRGNLKTPQLLADLTANRLQWQE
FT                   LHINRIKVDGDVRSTDQIQGQLAVRVEQLKQADFVVSLLTLDARGSEKQHQLRLNMQGD
FT                   PVSGQLSLEGSFDKQQQRWRGTLNNTRFDTPVGEWRLSRAMTLDYQNSAQRITIGPHCW
FT                   LNPNAELCAPRPIEAGPSGQASVVLNRFDLAMIKPFLGPDTTMNGVFTGRAEVSWKEGG
FT                   KLPDVRVSLSGNGVKVQQMVQGSPLPIAFETLNLNGGLANGQVRADWLVKLVNNGQFSG
FT                   QVQVADPEGRRNLSGNVAISNLSLAMINPILSDGEKAAGILNANLRLAGNAKSPLVYGR
FT                   LALDKVDIDGSWMPFDITEGRLAMNFDGMTSTLEGLIRTSQGQLNLSGDADWRDISAWH
FT                   ARIAAKGNKLRVTIPPTARVDVSPDIVFEATPQLFTLNGSVDIPWARITVQEVPETAVG
FT                   VSSNEVMLNDQLQPIAPRSASIPISSNLVIRIGNDVRLNAFGLKARLQGDLRMMQDQRG
FT                   LGLNGQINIPSGSFRAYGQDLIVNKGILLFSGPPDQPLLNIEAIRNPDSTANGVIAGVR
FT                   VTGMADSPRMEVFSDPAMSQQEALSYLLRGQGLGNSGADSSMMTSMLIGMGVAQSGKLV
FT                   GKIGEAFGVSNLALDTQGVGDSSQVVVSGYVTKDLQIKYGVGIFDSLATLTLRYRLMPR
FT                   LYLEAVSGIDQALDLLYQFEF"
     MKWVKRLSIA FLLIILLLVG ALGGLLGTTS GLHFLINSAA RWVPGLDIAS VSGGWRGLTL        60
     TGIQYQMPGV TVKAGQFYLS LQLSCLKNSE LCVNALTAQD IDVVVNTQAM PPTSSTPAST       120
     DPMGELSTPY PIFLRLLSLN NVKVTIDDTA ISLDEFRTGA HWKQRSLALM PTKINGLLIA       180
     LPKTVSAGVP DAVKPAVETA MAAKEAVAQL SAAPGRSATA SGQSTTASGR SATASGQSAT       240
     TGGQLATVPA EPATPLGESL KALFAKPLLP ALPDFRLPLD LQIEEISGQQ LRLTGDNEVL       300
     ISSLLLQAST QDQRITLDTL EIKSPQGGLS AQGQATLADK WPLDLVVNSA LNIDSLKGEK       360
     VKLTVGGALR EELKVTLNLS GPVSAQLETE TSLAKAGLPL SLTLQSKQLR WPLTGEPQYQ       420
     MNNLRMRLNG QATDYALSIR SDIKGTDLPP AVFTLEGKGN VEQFNLTRLR LAALQGHTDL       480
     TGVVDWRQAI SWNSVLTLSG INMAKQWPEW PAKLEGKIVT RGSIHGGSWQ LQVPELVLDG       540
     NVKQNRVTAR GSLTGNAAGQ WHIPGINLAL GRNKLDMKGE LNDNWLLDAN VDAPQLDGAL       600
     PGLGGVVKGS LKLRGNLKTP QLLADLTANR LQWQELHINR IKVDGDVRST DQIQGQLAVR       660
     VEQLKQADFV VSLLTLDARG SEKQHQLRLN MQGDPVSGQL SLEGSFDKQQ QRWRGTLNNT       720
     RFDTPVGEWR LSRAMTLDYQ NSAQRITIGP HCWLNPNAEL CAPRPIEAGP SGQASVVLNR       780
     FDLAMIKPFL GPDTTMNGVF TGRAEVSWKE GGKLPDVRVS LSGNGVKVQQ MVQGSPLPIA       840
     FETLNLNGGL ANGQVRADWL VKLVNNGQFS GQVQVADPEG RRNLSGNVAI SNLSLAMINP       900
     ILSDGEKAAG ILNANLRLAG NAKSPLVYGR LALDKVDIDG SWMPFDITEG RLAMNFDGMT       960
     STLEGLIRTS QGQLNLSGDA DWRDISAWHA RIAAKGNKLR VTIPPTARVD VSPDIVFEAT      1020
     PQLFTLNGSV DIPWARITVQ EVPETAVGVS SNEVMLNDQL QPIAPRSASI PISSNLVIRI      1080
     GNDVRLNAFG LKARLQGDLR MMQDQRGLGL NGQINIPSGS FRAYGQDLIV NKGILLFSGP      1140
     PDQPLLNIEA IRNPDSTANG VIAGVRVTGM ADSPRMEVFS DPAMSQQEAL SYLLRGQGLG      1200
     NSGADSSMMT SMLIGMGVAQ SGKLVGKIGE AFGVSNLALD TQGVGDSSQV VVSGYVTKDL      1260
     QIKYGVGIFD SLATLTLRYR LMPRLYLEAV SGIDQALDLL YQFEF                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page