(data stored in ACNUC9543 zone)

EMBL: CP000308.PE74

CP000308.PE74        Location/Qualifiers
FT   CDS             complement(91207..92943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12043"
FT                   /db_xref="GOA:A0A0E1NN71"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NN71"
FT                   /protein_id="ABG12043.1"
FT                   /translation="MLRYPILCFVCLLLATPIAYAANVRLQVEGLSGDLERNVRARLST
FT                   IGTDEVTADGRFRSRVDEAIRQGLRALGYYDPTITFELQNRPAPARSVLIAKVVPGEPV
FT                   LIAGVDIVLQGGAKTDPDYQALVRRDTPKIGSVLNHGDFDNFTSSLTGLALRRGYFDAN
FT                   MIKSQLGVAAQLHEAFWDIDFDSGQRYRFGKVIFQGSQIREDYLQNLVPFHEGEFYTSD
FT                   ELAELNRRLAATNWFNSVVVSPDFQDAKESKILPLDAVVTPRTENTVELGGGYATDVGP
FT                   RLTASWRKPWMNSFGHSLTTTTALSAPEQTLDFSYRIPLLRNPLEQYYLIQGGFRRTDL
FT                   NDTNSDTTTLNVARFWDLSSGWQRAINLRWSLDHFTQGRVTDTTMLLYPGVSINRTRQR
FT                   GGAMPVWGDSQRYSIDVSDTTWGSDVDFGIFQAQNVWIRTLGEKNRFVARGNVGWIETN
FT                   NFDRVPPSLRFFAGGDRSIRGYKFRNISPRDSDGKLTGASKLATGSLEYQYNFTGRWWG
FT                   AVFVDSGEAVNNFSKSDLKTGAGVGVRWASPVGPIKLDIAAPIGDNETHGVQFYIGLGP
FT                   EL"
     MLRYPILCFV CLLLATPIAY AANVRLQVEG LSGDLERNVR ARLSTIGTDE VTADGRFRSR        60
     VDEAIRQGLR ALGYYDPTIT FELQNRPAPA RSVLIAKVVP GEPVLIAGVD IVLQGGAKTD       120
     PDYQALVRRD TPKIGSVLNH GDFDNFTSSL TGLALRRGYF DANMIKSQLG VAAQLHEAFW       180
     DIDFDSGQRY RFGKVIFQGS QIREDYLQNL VPFHEGEFYT SDELAELNRR LAATNWFNSV       240
     VVSPDFQDAK ESKILPLDAV VTPRTENTVE LGGGYATDVG PRLTASWRKP WMNSFGHSLT       300
     TTTALSAPEQ TLDFSYRIPL LRNPLEQYYL IQGGFRRTDL NDTNSDTTTL NVARFWDLSS       360
     GWQRAINLRW SLDHFTQGRV TDTTMLLYPG VSINRTRQRG GAMPVWGDSQ RYSIDVSDTT       420
     WGSDVDFGIF QAQNVWIRTL GEKNRFVARG NVGWIETNNF DRVPPSLRFF AGGDRSIRGY       480
     KFRNISPRDS DGKLTGASKL ATGSLEYQYN FTGRWWGAVF VDSGEAVNNF SKSDLKTGAG       540
     VGVRWASPVG PIKLDIAAPI GDNETHGVQF YIGLGPEL                               578
//

If you have problems or comments...

PBIL Back to PBIL home page