(data stored in ACNUC9543 zone)

EMBL: CP000308.PE76

CP000308.PE76        Location/Qualifiers
FT   CDS             94134..95465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0076"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12045"
FT                   /db_xref="GOA:A0A0E1NPY6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY6"
FT                   /protein_id="ABG12045.1"
FT                   /translation="MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKLLADEGDTNAL
FT                   RVLKLQETPGMFFTVVQIGLNAVAILGGIVGDAAFSPSFKLVFERFMAPELADQASFVC
FT                   SFVLVTSLFILFADLTPKRIGMISPEAVAVRIVNPMRFCLMIFRPLVWFFNGMANLIFR
FT                   LFKLPMVRNDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENV
FT                   IYFDLRESEDSIKDKISTHPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRSALIVPDTLTLSEALESFKTAGEDFAVILNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   QEEQIVARDENSWLIEGGTPIEDVMRVLHIDDFPQSGNYETIGGFMMYMLRKIPKRTDF
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLSDQPAPILPKAPHESSDA"
     MLNSILLILF LIAVSAFFSL SEISLAASRK IKLKLLADEG DTNALRVLKL QETPGMFFTV        60
     VQIGLNAVAI LGGIVGDAAF SPSFKLVFER FMAPELADQA SFVCSFVLVT SLFILFADLT       120
     PKRIGMISPE AVAVRIVNPM RFCLMIFRPL VWFFNGMANL IFRLFKLPMV RNDDITSDDI       180
     YAVVEAGALA GVLRKQEHEL IENVFELESR TVPSSMTSRE NVIYFDLRES EDSIKDKIST       240
     HPHSKFLVCD GHIDQVVGYV DSKDLLNRVL GNQSLVLSSG VQIRSALIVP DTLTLSEALE       300
     SFKTAGEDFA VILNEYALVV GIITLNDVMT TLMGDLVGQG QEEQIVARDE NSWLIEGGTP       360
     IEDVMRVLHI DDFPQSGNYE TIGGFMMYML RKIPKRTDFV KYAGYKFEVV DIDSYKIDQL       420
     LVTRLSDQPA PILPKAPHES SDA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page