(data stored in ACNUC9543 zone)

EMBL: CP000308.PE78

CP000308.PE78        Location/Qualifiers
FT   CDS             96121..96684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12047"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQH6"
FT                   /protein_id="ABG12047.1"
FT                   /translation="MIKNSLLIISLIFTPLLVSAHNIQDNQRVPPVGVRDKGELDYDKT
FT                   TNQFNYKNWNSSQLPGKTRVIQHIAGRTSAKEMNAPLIDAIKQANLPRERYQTTTIVNT
FT                   DDAIIGTAMFVRNSIESSKREFPWSQFIIDSKGNVAKAWGLTEKSSAIVVLDPQGNVKF
FT                   VKDGALTSAEVQQVIDQLHQLVQQ"
     MIKNSLLIIS LIFTPLLVSA HNIQDNQRVP PVGVRDKGEL DYDKTTNQFN YKNWNSSQLP        60
     GKTRVIQHIA GRTSAKEMNA PLIDAIKQAN LPRERYQTTT IVNTDDAIIG TAMFVRNSIE       120
     SSKREFPWSQ FIIDSKGNVA KAWGLTEKSS AIVVLDPQGN VKFVKDGALT SAEVQQVIDQ       180
     LHQLVQQ                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page