(data stored in ACNUC9543 zone)

EMBL: CP000308.PE79

CP000308.PE79        Location/Qualifiers
FT   CDS             complement(96687..97427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0079"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12048"
FT                   /db_xref="GOA:A0A0E1NTT6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTT6"
FT                   /protein_id="ABG12048.1"
FT                   /translation="MLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAH
FT                   QIIKAGLARLTPDIPLLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIAL
FT                   IDQGEPVLGVVYVPVTEVMYSAANGQAWKEECGRRMQIQVRDAQPPLVVVSRSHSDAEL
FT                   EDYLSQLGEHQTISVGSSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHD
FT                   WQGKTLSYTPRESFLNPGFRVSLF"
     MLEQIGQLAR EAGVAIMAVY QGDKPLDIAH KKDDSPVTAA DLAAHQIIKA GLARLTPDIP        60
     LLSEEDPPAW DVRQHWQRYW LVDPLDGTKE FLNRNGEFTV NIALIDQGEP VLGVVYVPVT       120
     EVMYSAANGQ AWKEECGRRM QIQVRDAQPP LVVVSRSHSD AELEDYLSQL GEHQTISVGS       180
     SLKFCLVAEG KAQLYPRFGP TNVWDTAAGH AVAIAAGAQV HDWQGKTLSY TPRESFLNPG       240
     FRVSLF                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page