(data stored in ACNUC9543 zone)

EMBL: CP000308.PE81

CP000308.PE81        Location/Qualifiers
FT   CDS             99987..100652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12050"
FT                   /db_xref="GOA:Q1CBX2"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBX2"
FT                   /protein_id="ABG12050.1"
FT                   /translation="MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLN
FT                   LDIDALEAQLSALQTEPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVER
FT                   VHGEKPTCPRGLAAELSAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDA
FT                   VGQQLDVVKQLTQNVTPPEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE"
     MDYRNQSLGA LAIAIPRATK LFRQHQLDFC CGGKQTLLRA ANKLNLDIDA LEAQLSALQT        60
     EPHSSEDWQQ QPLTNLISFI ISRYHDRHRE QLPELVLMAE KVERVHGEKP TCPRGLAAEL       120
     SAILEELTQH MYKEEQILFP MIQRGMGSQA SGPIFVMEAE HDAVGQQLDV VKQLTQNVTP       180
     PEGACNTWRA LYTGINEFIT DLMEHIHLEN NLLFPRALRG E                           221
//

If you have problems or comments...

PBIL Back to PBIL home page