(data stored in ACNUC9543 zone)

EMBL: CP000308.PE84

CP000308.PE84        Location/Qualifiers
FT   CDS             102592..103047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12053"
FT                   /db_xref="InterPro:IPR022231"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWC8"
FT                   /protein_id="ABG12053.1"
FT                   /translation="MMKYQLSFVLLLTPLAVFAEQHCPAIDAIKLIGGVYTAKATSGEE
FT                   WVGILQGPLPQESGIKRFSEALFVVEGENNGNNVTGSGKFQKCTYDLQAENIQLDMYYG
FT                   GTTWIASIRGKPYWEYEKGGFFEIYTCSNVAPEYCKFDILVPGSASR"
     MMKYQLSFVL LLTPLAVFAE QHCPAIDAIK LIGGVYTAKA TSGEEWVGIL QGPLPQESGI        60
     KRFSEALFVV EGENNGNNVT GSGKFQKCTY DLQAENIQLD MYYGGTTWIA SIRGKPYWEY       120
     EKGGFFEIYT CSNVAPEYCK FDILVPGSAS R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page