(data stored in ACNUC9543 zone)

EMBL: CP000308.PE87

CP000308.PE87        Location/Qualifiers
FT   CDS             complement(104315..104542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0087"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12056"
FT                   /db_xref="GOA:Q1CBW6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBW6"
FT                   /protein_id="ABG12056.1"
FT                   /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
     MARYFRRRKF CRFTAEGVVE IDYKDIATLK NYITESGKIV PSRITGTRAK YQRQLARCIK        60
     RARYLSLLPY TDRHQ                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page