(data stored in ACNUC9543 zone)

EMBL: CP000308.PE9

CP000308.PE9         Location/Qualifiers
FT   CDS             7781..9649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0009"
FT                   /product="potassium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11978"
FT                   /db_xref="GOA:Q1CC44"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC44"
FT                   /protein_id="ABG11978.1"
FT                   /translation="MSTEHKQYLSAVTLAAIGVVYGDIGTSPLYTLRECFSGHYGFDVR
FT                   PDVVFGFLSLIFWMLILVVSVKYLTYVMRADNAGEGGILTLMSLAGRNTSSRATSILVV
FT                   LGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVLTLLFVIQKHGTG
FT                   SVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFVEYKSVSFFALGAVV
FT                   LAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKNPEAIKNPFFLLA
FT                   PDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIHTSEMESGQIYIP
FT                   VINWTLYLAVVLVIIGFERSSNLAAAYGIAVTGTMVITSILFCTVAWKNWHWNRFLVVF
FT                   LLMVLLIIDIPMFSANVLKLFSGGWLPLSLGLVMFIIMTTWKSERFSLLRRMHEHSNSL
FT                   EAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHERVVLLTMRTDDVPY
FT                   VHNVERVTIEQLSPTFWRVVARYGWRETPNVAEIFHRCGLEGLSCQMMETSFFMSHESL
FT                   ILTKRPWHLFLRGKLFIALSRNALRAPDQFEIPPNRVIELGTQVEI"
     MSTEHKQYLS AVTLAAIGVV YGDIGTSPLY TLRECFSGHY GFDVRPDVVF GFLSLIFWML        60
     ILVVSVKYLT YVMRADNAGE GGILTLMSLA GRNTSSRATS ILVVLGLIGG SFFYGEVVIT       120
     PAISVMSAIE GLEIAAPALD PYIVPCSIAV LTLLFVIQKH GTGSVGKLFA PVMLVWFLTL       180
     ALLGLRSIIA NPEVLAALNP KWAISFFVEY KSVSFFALGA VVLAITGVEA LYADMGHFGK       240
     FPIRLAWFTV VLPSLVLNYF GQGALLLKNP EAIKNPFFLL APDWALIPLL ILATLATVIA       300
     SQAVISGVFS LTRQAVRLGY LPPMRIIHTS EMESGQIYIP VINWTLYLAV VLVIIGFERS       360
     SNLAAAYGIA VTGTMVITSI LFCTVAWKNW HWNRFLVVFL LMVLLIIDIP MFSANVLKLF       420
     SGGWLPLSLG LVMFIIMTTW KSERFSLLRR MHEHSNSLEA MIASLEKSPP VRVPGTAVYM       480
     SRAMNVIPFA LLHNLKHNKV LHERVVLLTM RTDDVPYVHN VERVTIEQLS PTFWRVVARY       540
     GWRETPNVAE IFHRCGLEGL SCQMMETSFF MSHESLILTK RPWHLFLRGK LFIALSRNAL       600
     RAPDQFEIPP NRVIELGTQV EI                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page